LL-37 Peptide Therapy in Logansport, IN
LL-37 peptide therapy is based on a naturally occurring human host-defense peptide that participates in innate immunity, antimicrobial activity, wound healing and inflammatory signaling.
LL-37 is the active C-terminal fragment of the human cathelicidin precursor protein hCAP18. It contains 37 amino acids and is produced by cells including neutrophils, macrophages and epithelial cells.
Research has reported biological activity involving:
- Gram-positive and gram-negative bacteria
- Selected fungi and viruses
- Bacterial biofilms
- Immune-cell recruitment
- Inflammatory signaling
- Keratinocyte migration
- Re-epithelialization
- Blood-vessel formation
- Wound healing
LL-37 is one of the better-studied human antimicrobial peptides, but that does not mean every marketed form of LL-37 has established clinical benefit.
The strongest direct therapeutic human evidence involves topical LL-37 applied to chronic venous leg ulcers. Evidence for subcutaneous injection, systemic immune support, chronic-infection treatment or wellness use remains much more limited.
LL-37 is not an FDA-approved medication in the United States.
To learn more about physician-guided immune, wound-healing and integrative treatment options in Logansport, IN, call (765) 259-0545 or contact Charles Turner MD online.
What Is LL-37?
LL-37 is the only known human cathelicidin-derived antimicrobial peptide.
The name LL-37 reflects two features:
- It begins with two leucine amino acids, represented by the letters LL
- The mature peptide contains 37 amino acids
Its amino-acid sequence is:
[LL-37, 37 aa]
LL-37 is positively charged and amphipathic. This structure helps it interact with microbial membranes and participate in cellular signaling.
What Is hCAP18?
LL-37 is not produced initially as a free 37-amino-acid peptide.
Human cells first produce a larger precursor protein called:
Human cationic antimicrobial protein 18, or hCAP18
hCAP18 is encoded by the CAMP gene.
Enzymatic processing cleaves the precursor and releases LL-37.
This precursor system helps regulate when and where active antimicrobial peptide is generated.
Where Is LL-37 Produced?
LL-37 or its precursor is produced in several tissues and cell types, including:
- Neutrophils
- Monocytes and macrophages
- Keratinocytes
- Airway epithelial cells
- Gastrointestinal epithelial cells
- Genitourinary epithelial cells
- Salivary and other glandular tissues
Expression often increases after:
- Skin injury
- Microbial exposure
- Inflammatory signaling
- Selected vitamin D receptor signals
LL-37 is therefore part of the body's natural innate immune defense system .
Is LL-37 an Antibiotic?
LL-37 is an antimicrobial peptide, but it is not a conventional antibiotic medication.
Traditional antibiotics usually target specific bacterial functions such as:
- Cell-wall synthesis
- Protein synthesis
- DNA replication
- Metabolic pathways
LL-37 can interact directly with microbial membranes and also influence host immune responses.
This combination has led researchers to use the broader term host-defense peptide.
LL-37 should not replace an established antibiotic when a patient has a bacterial infection that requires antimicrobial treatment.
How Does LL-37 Kill Microorganisms?
Many microbial membranes contain negatively charged components that attract positively charged LL-37.
Depending on the organism and experimental conditions, LL-37 may:
- Bind to microbial surfaces
- Disrupt membrane integrity
- Alter membrane permeability
- Interfere with microbial metabolism
- Reduce bacterial attachment
- Influence biofilm development
The antimicrobial activity observed in a laboratory dish does not always translate directly into the human body.
Factors that can influence activity include:
- Salt concentration
- Serum proteins
- Proteolytic enzymes
- Peptide concentration
- Microbial species
- Biofilm structure
- Local tissue conditions
LL-37 Is More Than an Antimicrobial Peptide
Researchers now recognize that direct microbial killing is only one part of LL-37 biology.
LL-37 also functions as a signaling molecule that can influence:
- Chemotaxis
- Cytokine production
- Macrophage responses
- Neutrophil activity
- Keratinocyte migration
- Endothelial cells
- Angiogenesis
- Wound closure
- Recognition of nucleic acids
These effects can be beneficial in one biological context and harmful in another.
That is why describing LL-37 simply as an “immune booster” is medically incomplete.
How Does LL-37 Affect the Immune System?
LL-37 participates in both direct host defense and immune regulation.
Experimental research has reported effects involving:
- Recruitment of immune cells
- Modulation of macrophage responses
- Neutralization of selected bacterial products such as lipopolysaccharide
- Changes in cytokine signaling
- Interaction with pattern-recognition pathways
- Coordination between epithelial cells and leukocytes
Potential signaling partners include receptors such as FPR2 and P2X7 as well as other membrane and intracellular systems.
LL-37 does not act through one single receptor.
Is LL-37 Anti-Inflammatory?
LL-37 can have both anti-inflammatory and pro-inflammatory effects.
In some experimental settings, LL-37 can:
- Bind bacterial endotoxin
- Reduce selected inflammatory responses
- Support resolution of infection-associated inflammation
In other settings, LL-37 can:
- Activate inflammatory signaling
- Promote cytokine release
- Enhance recognition of self-DNA or self-RNA
- Contribute to inflammatory skin disease
The effect depends on concentration, tissue, associated molecules and disease state.
For this reason, LL-37 should not be presented as a universal treatment for inflammation .
Why Are Patients Interested in LL-37 Peptide Therapy?
Patients may encounter LL-37 while researching peptide therapy for:
- Immune support
- Chronic wounds
- Biofilms
- Chronic bacterial infections
- Skin healing
- MRSA-related research
- Chronic inflammatory symptoms
- Gastrointestinal health
- Respiratory health
- Post-procedure recovery
These uses do not have equal levels of evidence.
Human treatment research is most developed for topical LL-37 in chronic venous wounds.
What Does Human LL-37 Research Show?
Human research includes several different types of evidence:
- Studies measuring naturally occurring LL-37 in human tissue
- Human skin-wounding studies
- Human cell and ex vivo tissue experiments
- Topical therapeutic trials in chronic venous leg ulcers
Evidence for systemic injection is far less developed.
LL-37 in Normal Human Wound Healing
Human skin studies demonstrate that the hCAP18/LL-37 system becomes activated after injury.
Researchers have reported:
- Increased cathelicidin expression after cutaneous injury
- LL-37-related immunoreactivity within inflammatory cells
- Expression in epithelial cells migrating over the wound
- Reduced LL-37 expression at the edge of some chronic ulcers
In an ex vivo human-skin wound model, blocking LL-37 activity inhibited re-epithelialization.
This supports a physiological role for LL-37 in normal skin repair.
First-in-Human Randomized LL-37 Wound Trial
A randomized, double-blind, placebo-controlled first-in-human study evaluated topical synthetic LL-37 in 34 adults with hard-to-heal venous leg ulcers.
Participants received twice-weekly topical treatment with:
- 0.5 mg/mL LL-37
- 1.6 mg/mL LL-37
- 3.2 mg/mL LL-37
- Placebo
The randomized treatment phase lasted four weeks.
Researchers reported that the two lower concentrations produced favorable wound-healing findings.
At the 0.5 mg/mL concentration:
- The calculated healing-rate constant was approximately six times higher than placebo
- Mean ulcer area decreased substantially during treatment
The 1.6 mg/mL group also showed favorable wound-area changes.
The highest 3.2 mg/mL concentration did not outperform placebo.
This dose pattern is important because it demonstrates that more LL-37 did not produce better healing.
No major local or systemic safety concern was identified during the short trial.
What Happened in the Larger Phase IIb LL-37 Trial?
A later multicenter Phase IIb trial evaluated topical LL-37 in 148 adults with hard-to-heal venous leg ulcers.
This larger study is important because its results were more cautious than the first trial.
Across the full study population, LL-37 did not produce a statistically significant improvement in healing compared with placebo.
Researchers did identify favorable findings in a post hoc subgroup of patients whose wounds were at least 10 square centimeters at randomization.
However, subgroup findings generated after examining the data require confirmation in a trial designed specifically to test that population.
The study therefore does not support presenting LL-37 as a proven treatment for all chronic venous ulcers.
Why Can Lower LL-37 Doses Perform Differently From Higher Doses?
LL-37 is a biological signaling peptide rather than a simple nutrient.
Its effects can change according to concentration.
At different concentrations, LL-37 may influence:
- Cell migration
- Inflammatory signaling
- Membrane integrity
- Immune activation
- Cytotoxicity
- Angiogenesis
The positive first-in-human wound trial found benefit at lower studied concentrations but not at the highest concentration.
This is one reason unsupervised dose escalation is inappropriate.
LL-37 and Re-Epithelialization
Re-epithelialization is the process by which skin cells migrate across a wound and restore the epithelial surface.
Human skin research indicates that LL-37 participates in this process.
Potential mechanisms include:
- Keratinocyte migration
- Cellular signaling
- Control of local microbial burden
- Coordination with inflammatory cells
- Support of vascular development
This research supports interest in peptide treatment for wound and scar healing.
LL-37 and Angiogenesis
Angiogenesis is the formation of new blood vessels.
New microvessels are important during tissue repair because healing tissue needs:
- Oxygen
- Nutrients
- Immune-cell access
- Waste removal
Laboratory and animal studies have reported that LL-37 can activate endothelial cells and support new-vessel formation.
Research has implicated pathways involving formyl-peptide receptors and prostaglandin signaling.
Angiogenesis is not universally beneficial, however. Excess or inappropriate blood-vessel formation may contribute to selected inflammatory or neoplastic conditions.
LL-37 for Venous Leg Ulcers
Venous leg ulcers often develop when chronic venous hypertension damages skin and soft tissue.
Standard treatment may include:
- Compression therapy
- Wound cleaning
- Debridement
- Appropriate dressings
- Management of edema
- Treatment of venous reflux when appropriate
- Infection treatment when present
Topical LL-37 has been studied as an adjunct to this kind of wound care.
Patients with venous wounds should receive appropriate evaluation for chronic venous insufficiency and venous ulcer treatment.
LL-37 should not replace compression or vascular evaluation.
LL-37 for Stasis Ulcers
Stasis ulcers are commonly related to chronic venous hypertension.
Because topical LL-37 has been studied in hard-to-heal venous leg ulcers, patients may encounter LL-37 when researching stasis ulcer treatment.
The research does not establish an FDA-approved LL-37 wound product.
Any chronic ulcer requires evaluation for:
- Venous disease
- Arterial insufficiency
- Diabetes
- Infection
- Pressure
- Neuropathy
- Malignancy in selected nonhealing wounds
LL-37 for Diabetic Wounds
LL-37 has attracted interest in diabetic-wound research because chronic wounds often involve:
- Impaired immune defense
- Biofilm formation
- Poor vascular supply
- Persistent inflammation
- Reduced re-epithelialization
Preclinical studies have evaluated LL-37 hydrogels, nanoparticles and controlled-release systems in diabetic or pressure-wound models.
However, the direct randomized human LL-37 therapeutic evidence is primarily in venous leg ulcers rather than diabetic foot ulcers.
Patients with diabetes and an open foot wound require immediate diabetic foot care because infection, ischemia and osteomyelitis can threaten the limb.
LL-37 and Biofilms
A biofilm is an organized microbial community embedded within a protective extracellular matrix.
Biofilms can make microorganisms more difficult to eradicate because they can:
- Reduce antimicrobial penetration
- Alter bacterial metabolic activity
- Increase tolerance to antibiotics
- Protect organisms from immune clearance
- Support persistent colonization
LL-37 has demonstrated significant antibiofilm activity in laboratory studies.
Importantly, some antibiofilm effects occur at concentrations below those required to directly kill bacteria.
LL-37 and Pseudomonas Biofilms
Pseudomonas aeruginosa is an important biofilm-forming pathogen associated with chronic wounds, respiratory disease and healthcare-associated infection.
Laboratory research reported that LL-37 reduced Pseudomonas biofilm formation at low concentrations.
Proposed mechanisms included:
- Reduced bacterial attachment
- Changes in twitching motility
- Altered quorum-sensing pathways
- Changes in biofilm-associated gene expression
These findings are promising but do not establish injected LL-37 as a treatment for Pseudomonas infection.
LL-37 and Staphylococcus aureus Biofilms
Staphylococcus aureus is an important cause of skin, wound and device-related infection.
Laboratory studies have reported strong LL-37 activity against selected S. aureus biofilms.
One study using mature S. aureus biofilms on cobalt-chromium surfaces reported a substantial reduction in bacterial colony counts after LL-37 exposure.
Another study evaluating S. aureus strains isolated from chronic wounds reported antimicrobial and antibiofilm activity against both methicillin-sensitive and methicillin-resistant organisms.
These studies support continued research but do not replace clinical staph infection treatment.
LL-37 and MRSA
Methicillin-resistant Staphylococcus aureus, or MRSA, is resistant to many commonly used antibiotics.
LL-37 and LL-37-derived experimental peptides have demonstrated activity against MRSA in laboratory and ex vivo skin models.
This has made antimicrobial peptides attractive candidates for new topical drugs.
There is not enough evidence to recommend systemic or injectable LL-37 as a substitute for established MRSA treatment.
Serious MRSA infection may require culture-directed antibiotics, drainage, hospitalization or surgical management.
LL-37 for Chronic Infection
Patients sometimes encounter LL-37 in protocols marketed for chronic infection because of its broad laboratory antimicrobial activity.
However, chronic symptoms should not automatically be attributed to persistent microbial infection.
There are no large controlled human trials establishing LL-37 injections as treatment for:
- Chronic bacterial infection
- Persistent viral infection
- Systemic fungal infection
- Chronic Lyme disease
- Recurrent biofilm-associated illness
- Post-infectious fatigue syndromes
When infection is suspected, diagnosis should be based on appropriate examination, cultures, molecular tests, imaging or other evidence.
LL-37 and Lyme Disease
Some peptide clinics market LL-37 for Lyme disease or chronic Lyme-related symptoms.
LL-37 has broad antimicrobial and immune effects in laboratory research, but controlled human trials have not established LL-37 as treatment for Borrelia infection.
Patients with confirmed Lyme disease should receive guideline-based antimicrobial treatment when indicated.
Persistent symptoms after appropriate treatment require evaluation for alternative causes rather than automatic escalation to experimental antimicrobial peptides.
LL-37 and Fungal Research
LL-37 has demonstrated laboratory activity against selected fungal organisms.
This is part of its broad host-defense role.
However, human clinical evidence does not establish LL-37 peptide therapy as a treatment for systemic candidiasis or recurrent fungal infection.
Serious fungal disease requires established antifungal therapy.
LL-37 and Viral Research
Experimental studies have reported interactions between LL-37 and selected viruses.
Potential mechanisms may involve:
- Direct disruption of viral envelopes
- Binding viral components
- Modulating innate immune responses
Antiviral activity in vitro does not mean LL-37 can replace vaccination or antiviral medication.
There is no FDA-approved LL-37 antiviral indication.
LL-37 and Atopic Dermatitis
Human studies have found lower antimicrobial-peptide expression in inflamed skin from patients with atopic dermatitis compared with psoriatic skin.
Reduced antimicrobial defense may contribute to the susceptibility of some patients with eczema to Staphylococcus aureus colonization and infection.
This finding supports the importance of endogenous LL-37 biology.
It does not establish topical or injected LL-37 as an approved eczema treatment.
LL-37 and Psoriasis
LL-37 illustrates why immune peptides are biologically complex.
In psoriasis, LL-37 may contribute to disease rather than simply reduce inflammation.
LL-37 can bind self-DNA or self-RNA and help deliver these molecules to immune-recognition pathways.
This can stimulate plasmacytoid dendritic cells and other inflammatory responses associated with psoriasis.
Patients with psoriasis should not assume that increasing LL-37 is beneficial.
LL-37 and Rosacea
Abnormal processing and increased activity of cathelicidin peptides are involved in rosacea biology.
Research has linked LL-37 to:
- Inflammatory signaling
- IL-1 beta activity
- Vascular responses
- Angiogenesis
- Keratinocyte inflammatory pathways
Excess or abnormal LL-37 signaling may therefore contribute to rosacea rather than treat it.
This is another reason LL-37 should not be described as uniformly anti-inflammatory.
LL-37 and Autoimmune Disease
LL-37 has been studied extensively in autoimmunity.
In some autoimmune settings, the peptide can form complexes with self-nucleic acids and amplify innate immune activation.
This has been investigated particularly in:
- Psoriasis
- Lupus-related pathways
- Other inflammatory disorders
Patients with autoimmune disease should not use LL-37 under the assumption that immune stimulation is always desirable.
Autoimmune disease usually requires regulation of inappropriate immune activity, not nonspecific immune enhancement.
LL-37 and Cancer Biology
LL-37 can influence:
- Cell migration
- Cell proliferation
- Inflammatory signaling
- Angiogenesis
- Interactions within the tumor microenvironment
Preclinical cancer research has produced mixed findings.
LL-37-related signaling has been associated with pro-tumor effects in some tissues and anti-tumor effects in others.
FDA has specifically identified nonclinical concern that LL-37 may be protumorigenic in selected tissues.
There is no evidence establishing that LL-37 peptide therapy is safe for every person with active or previous cancer.
Patients with active malignancy, unexplained masses or recent cancer treatment should discuss any investigational peptide with their oncologist.
LL-37 and Male Fertility
Nonclinical and laboratory reproductive research has raised an additional safety concern.
LL-37 can bind to human sperm membranes at sufficient concentrations.
Experimental exposure has been associated with:
- Reduced sperm motility
- Membrane disruption
- Premature acrosomal changes
- Reduced fertilizing capacity in animal experiments
This does not establish that therapeutic LL-37 exposure causes infertility in patients.
It does mean men who are actively trying to conceive should discuss these uncertainties with their physician before considering systemic LL-37.
LL-37 and Vitamin D
Vitamin D signaling is one of the physiological regulators of the human CAMP gene that produces hCAP18.
Human skin research has shown that a topical vitamin D analogue can increase hCAP18/LL-37 expression after skin injury.
This relationship does not mean every patient with low vitamin D has an LL-37 deficiency.
Likewise, increasing vitamin D does not reproduce the effects of applying synthetic LL-37.
Patients with suspected vitamin D deficiency should receive appropriate testing and treatment based on vitamin D status.
LL-37 and Skin Barrier Defense
Healthy skin provides multiple layers of antimicrobial protection.
LL-37 contributes to this defense by participating in:
- Microbial control
- Communication with immune cells
- Wound responses
- Epithelial repair
Barrier health also depends on:
- Intact keratinocytes
- Skin lipids
- Normal microbiome composition
- Appropriate moisture
- Immune regulation
More LL-37 is not automatically equivalent to a healthier skin barrier.
LL-37 for Gut Health
Cathelicidin peptides are involved in mucosal immunity, including gastrointestinal defense.
Laboratory research has examined LL-37 interactions with:
- Intestinal epithelial cells
- Bacteria
- Inflammatory signaling
- Mucosal immune responses
There is no controlled human evidence establishing LL-37 injections as treatment for:
- Irritable bowel syndrome
- Inflammatory bowel disease
- Crohn's disease
- Ulcerative colitis
- Increased intestinal permeability
Patients with persistent gastrointestinal symptoms require diagnosis-directed care.
LL-37 for Respiratory Health
LL-37 is present in airway secretions and contributes to respiratory innate immunity.
Research has examined its role in:
- Bacterial defense
- Viral defense
- Airway inflammation
- Epithelial repair
There is no FDA-approved inhaled, nasal or injectable LL-37 therapy for asthma, chronic obstructive pulmonary disease, recurrent pneumonia or viral respiratory infection.
Topical LL-37 Therapy
Topical treatment has the strongest direct human therapeutic evidence for LL-37.
A topical approach offers theoretical advantages because it can:
- Expose the wound directly to the peptide
- Limit systemic exposure
- Target local epithelial and immune cells
- Avoid gastrointestinal peptide degradation
However, topical peptide formulations require careful pharmaceutical design.
Important factors include:
- Peptide concentration
- Vehicle
- Protease protection
- pH
- Stability
- Frequency of application
- Wound environment
The formulation used in a clinical trial should not be assumed equivalent to an independently compounded cream or gel.
LL-37 Injections
Some peptide clinics and online sellers market LL-37 for subcutaneous injection.
This route does not have the same evidence base as topical LL-37 wound treatment.
Controlled human trials have not established subcutaneous LL-37 injections for:
- Immune enhancement
- Biofilm treatment
- Chronic Lyme disease
- Chronic infection
- Gut healing
- Systemic inflammation
- General wellness
Systemic exposure may also create different biological and safety effects than local topical exposure.
Human topical wound-study doses should not be converted into injectable dosing schedules.
LL-37 Nasal Spray
Intranasal peptide delivery is used for some investigational compounds, but there is no FDA-approved LL-37 nasal spray.
Controlled human evidence has not established intranasal LL-37 for:
- Sinus infection
- Respiratory infection
- Immune support
- Neurological health
Direct nasal administration could also expose sensitive mucosal tissue to a peptide with concentration-dependent inflammatory effects.
Oral LL-37
Peptides taken orally may be degraded by gastric acid and digestive enzymes.
No established oral LL-37 drug formulation has demonstrated clinical effectiveness for systemic immune or infection treatment.
Oral products marketed as LL-37 should not be assumed to deliver intact therapeutic peptide into the bloodstream.
Is There an Established LL-37 Dose?
No FDA-approved therapeutic dose exists.
Research doses differ according to:
- Topical vs. experimental systemic administration
- Wound size
- Formulation
- Species
- Study objective
The human venous-ulcer studies evaluated defined topical concentrations, not standardized subcutaneous doses.
The first human wound study also demonstrated that the highest topical concentration was not the most effective.
How Long Is LL-37 Therapy Used?
No standard outpatient treatment duration has been established.
Human topical trials treated wounds over defined short study periods.
There is insufficient controlled human evidence to establish safe and effective long-term systemic cycles for immune or antimicrobial use.
Current FDA Status of LL-37
LL-37 is not an FDA-approved medication.
There is no FDA-approved LL-37 product for:
- Wound healing
- Venous ulcers
- MRSA
- Biofilms
- Lyme disease
- Immune support
- Inflammation
- Gastrointestinal disease
- Respiratory disease
- General wellness
FDA approval of other antimicrobial or wound products should not be confused with approval of LL-37.
Current U.S. Compounding Status of LL-37
LL-37 requires particular regulatory caution.
FDA previously evaluated a nomination for cathelicidin LL-37 within its bulk-drug-substance compounding process.
FDA currently identifies cathelicidin LL-37 among bulk drug substances that were nominated but later withdrawn.
FDA's current May 2026 list of 503A Category 1 substances under evaluation does not include LL-37.
FDA has also published identified concerns regarding compounded LL-37, including:
- Potential immunogenicity for certain routes
- Peptide-related impurities
- Complexity of active-pharmaceutical-ingredient characterization
- Insufficient safety information
- Nonclinical male reproductive concerns
- Potential protumorigenic effects in selected tissues
Under Section 503A, bulk drug substances generally must meet applicable statutory requirements, such as having an applicable USP or NF monograph, being a component of an FDA-approved drug product or appearing on the FDA 503A Bulks List when the other conditions do not apply.
A withdrawn nomination does not provide the interim Category 1 enforcement pathway.
Providers and pharmacies should verify current federal and state requirements before representing compounded LL-37 as a treatment option.
A Compounded LL-37 Product Is Not FDA-Approved
Even when a compounded medication is legally prepared for an individual patient, compounded drugs are not FDA-approved.
FDA does not conduct the same premarket review of a compounded formulation for:
- Safety
- Effectiveness
- Manufacturing quality
- Stability
- Labeling
Patients should not purchase products marketed only as “research use only” for self-injection.
Why Product Quality Matters for LL-37
Peptides can be difficult to manufacture and characterize.
Potential quality issues include:
- Incorrect amino-acid sequence
- Truncated peptides
- Deletion or insertion impurities
- Oxidation
- Aggregation
- Residual manufacturing chemicals
- Incorrect concentration
- Microbial contamination
- Endotoxin contamination
These concerns are particularly important for injectable products because they bypass the skin and gastrointestinal barriers.
What Are the Possible Side Effects of LL-37?
A complete human systemic safety profile has not been established.
Potential concerns may include:
- Injection-site pain
- Redness or swelling
- Topical irritation
- Allergic or immune reactions
- Inflammatory activation
- Effects on blood vessels and angiogenesis
- Unexpected tissue-specific effects
- Potential effects on sperm at sufficient exposure
- Unknown long-term effects
Topical wound studies cannot establish the safety of repeated systemic injections.
Why LL-37 Can Be Both Helpful and Harmful
LL-37 illustrates a central principle in immunology: a molecule that is beneficial during a controlled host-defense response can become harmful when its amount, location or timing is abnormal.
Potentially beneficial roles include:
- Microbial defense
- Biofilm suppression
- Wound closure
- Immune-cell coordination
Potentially harmful roles include:
- Excess inflammatory signaling
- Activation of self-nucleic-acid immune pathways
- Rosacea-associated inflammation
- Psoriasis-associated immune activation
- Potential unwanted angiogenesis
This complexity argues for condition-specific treatment rather than nonspecific “immune boosting.”
Who Should Use Extra Caution With LL-37?
Particular caution is appropriate for patients who:
- Are pregnant or breastfeeding
- Are actively trying to conceive
- Have active or previous cancer
- Have an unexplained mass
- Have psoriasis or another autoimmune condition
- Have rosacea
- Have significant inflammatory disease
- Use immune-suppressing medication
- Have a severe active infection requiring established treatment
- Have significant liver or kidney disease
- Have a history of serious reactions to injectable peptides
The absence of these conditions does not establish that LL-37 is appropriate or legally available.
Physician-Guided LL-37 Evaluation
A consultation should begin with the medical problem rather than with a predetermined peptide.
Your physician may review:
- Type and duration of symptoms
- History of recurrent infection
- Culture or laboratory results
- Wound characteristics
- Circulation
- Diabetes status
- Immune disorders
- Autoimmune disease
- Cancer history
- Fertility goals
- Current antibiotics or immune medications
- Previous peptide use
Many conditions marketed as reasons for LL-37 have established diagnostic and treatment pathways that should be evaluated first.
Testing Before Considering LL-37
There is no validated blood test that determines whether a person has an LL-37 deficiency requiring peptide replacement.
Testing should be based on the clinical concern.
Possible assessments may include:
- Complete blood count
- Comprehensive metabolic panel
- Inflammatory markers
- Blood cultures when indicated
- Wound cultures
- Urine or respiratory cultures
- Blood glucose and hemoglobin A1c
- Vascular testing for chronic leg wounds
- Immune evaluation when recurrent infection is documented
- Vitamin D testing when clinically appropriate
- Additional blood testing based on symptoms
Testing should help identify a diagnosis rather than simply justify experimental treatment.
LL-37 vs. Conventional Antibiotics
| Comparison | LL-37 | Conventional Antibiotics |
|---|---|---|
| Type | Human host-defense peptide | Multiple established antimicrobial drug classes |
| Mechanisms | Membrane effects plus immune and biofilm signaling | Drug-specific bacterial targets |
| Human clinical evidence | Limited, strongest for topical chronic-wound research | Extensive condition-specific clinical evidence |
| Culture-directed treatment | Not standardized | Frequently guided by susceptibility testing |
| FDA-approved infection indications | None | Numerous approved products |
LL-37 should not delay appropriate antibiotic treatment for a serious bacterial infection.
LL-37 vs. KPV
LL-37 and KPV peptide therapy are both discussed in immune and inflammatory peptide medicine, but they are very different.
| Comparison | LL-37 | KPV |
|---|---|---|
| Length | 37 amino acids | 3 amino acids |
| Origin | Human cathelicidin hCAP18 | Alpha-MSH fragment |
| Research focus | Host defense, antimicrobial activity, biofilms and wound healing | Inflammatory signaling, intestinal and skin-cell research |
| Human therapeutic research | Randomized topical wound trials | No established controlled therapeutic human trial |
| FDA-approved treatment | No | No |
LL-37 vs. Thymosin Alpha 1
LL-37 and thymosin alpha 1 peptide therapy both interact with immune biology, but they should not be treated as interchangeable.
LL-37 is an innate host-defense peptide with direct antimicrobial and biofilm-related activity.
Thymosin alpha 1 is an immune-modulating peptide studied in infectious disease, immune dysfunction and supportive oncology settings.
Their mechanisms, clinical evidence and regulatory histories differ.
LL-37 vs. VIP Peptide Therapy
LL-37 and VIP peptide therapy are also different.
LL-37 primarily relates to:
- Innate antimicrobial defense
- Biofilms
- Wound healing
- Inflammatory signaling
VIP primarily relates to:
- Neuroimmune signaling
- Vascular tone
- Airway relaxation
- Gastrointestinal signaling
Controlled human studies have not established that combining LL-37 and VIP improves outcomes.
Can LL-37 Be Combined With Other Peptides?
Some peptide practices combine LL-37 with treatments aimed at immune, gut or recovery goals.
Controlled human evidence for most LL-37 combinations is lacking.
Combining multiple investigational therapies can make it harder to determine:
- Which treatment produced improvement
- Which treatment caused an adverse effect
- Whether every component is necessary
A stepwise integrative medicine plan may make treatment response easier to interpret.
How Is Progress Monitored?
Monitoring depends on the condition being addressed.
For wound-related treatment, useful measures may include:
- Wound area
- Wound depth
- Rate of closure
- Drainage
- Granulation tissue
- Signs of infection
- Pain
- Photographic documentation
For infection-related concerns, monitoring may include:
- Temperature
- Symptoms
- Culture results
- Inflammatory markers
- Imaging when indicated
- Response to established antimicrobial therapy
Any experimental therapy should be discontinued or reassessed when adverse effects occur or measurable benefit is absent.
Frequently Asked Questions About LL-37 Peptide Therapy
What is LL-37 peptide therapy?
LL-37 peptide therapy refers to use of synthetic LL-37, a 37-amino-acid human cathelicidin peptide involved in antimicrobial defense, immune signaling and wound healing. There is no FDA-approved LL-37 medication.
What does LL-37 stand for?
The peptide begins with two leucine amino acids, abbreviated LL, and contains 37 amino acids.
Is LL-37 naturally produced by humans?
Yes. LL-37 is produced from the human hCAP18 cathelicidin precursor encoded by the CAMP gene.
What does LL-37 do?
LL-37 participates in innate antimicrobial defense, biofilm regulation, immune-cell signaling, keratinocyte migration, angiogenesis and wound healing.
Is LL-37 an antimicrobial peptide?
Yes. LL-37 is the best-characterized human cathelicidin antimicrobial peptide and is also described as a host-defense peptide because it has extensive immune-signaling functions.
Does LL-37 kill bacteria?
LL-37 can kill or inhibit selected bacteria in laboratory models. Activity depends on concentration, organism and environmental conditions. This does not make LL-37 a substitute for prescribed antibiotics.
Does LL-37 kill MRSA?
Laboratory and ex vivo studies have reported activity against MRSA and MRSA biofilms. Controlled human trials have not established LL-37 as a clinical MRSA treatment.
Does LL-37 break down biofilms?
LL-37 has demonstrated significant antibiofilm effects in laboratory studies involving organisms such as Pseudomonas aeruginosa and Staphylococcus species. Human systemic treatment evidence is lacking.
Can LL-37 treat chronic infections?
There are no large controlled human trials establishing LL-37 injections as a treatment for chronic systemic infection.
Can LL-37 treat Lyme disease?
No controlled human trial has established LL-37 as treatment for Lyme disease or persistent Borrelia infection.
Does LL-37 help wound healing?
Human skin research supports a role in re-epithelialization, and a small randomized first-in-human trial reported favorable healing measures with selected topical LL-37 concentrations in chronic venous ulcers.
Was LL-37 successful in clinical trials?
Results have been mixed. A 34-patient first-in-human trial reported favorable outcomes at lower topical concentrations. A later 148-patient Phase IIb trial did not show a significant benefit across the full population, although a post hoc subgroup with larger wounds showed favorable findings.
Can LL-37 heal diabetic foot ulcers?
Preclinical wound models are promising, but direct randomized human LL-37 evidence is stronger for venous leg ulcers than diabetic foot ulcers. Diabetic wounds require established multidisciplinary care.
Can LL-37 help venous ulcers?
Topical LL-37 has been evaluated in randomized human venous-ulcer trials. The initial trial was favorable at selected doses, while the larger Phase IIb trial was negative in the full study population.
Does LL-37 increase angiogenesis?
Preclinical studies show that LL-37 can activate endothelial cells and support new-vessel formation. This may contribute to wound healing but also creates theoretical concerns in conditions where angiogenesis is undesirable.
Is LL-37 anti-inflammatory?
Not always. LL-37 can suppress some infection-related inflammatory signals but can also promote inflammation in other settings, including pathways involved in psoriasis and rosacea.
Can LL-37 help autoimmune disease?
LL-37 is not an established autoimmune treatment. In some autoimmune conditions, LL-37 may actually amplify immune recognition of self-DNA or self-RNA.
Can LL-37 help eczema?
Patients with atopic dermatitis may have reduced antimicrobial-peptide expression in affected skin, but therapeutic LL-37 has not been established as an eczema treatment.
Can LL-37 make rosacea worse?
Abnormal cathelicidin processing and LL-37-related signaling are involved in rosacea inflammation. Increasing LL-37 should not be assumed beneficial in patients with rosacea.
Can LL-37 make psoriasis worse?
LL-37 participates in immune pathways implicated in psoriasis, including complexes with self-nucleic acids that activate inflammatory signaling. It is not a psoriasis treatment.
Does vitamin D increase LL-37?
Vitamin D receptor signaling can increase expression of the CAMP gene that produces the hCAP18 precursor. Human skin studies have demonstrated this relationship.
Is low vitamin D the same as low LL-37?
No. Vitamin D is one regulator of cathelicidin expression, but a vitamin D blood level does not directly diagnose an LL-37 deficiency.
Can LL-37 be injected?
LL-37 is marketed by some peptide sources for injection, but controlled human evidence does not establish subcutaneous injections for immune support, biofilms or chronic infection.
Is topical LL-37 better studied than injectable LL-37?
Yes. The strongest human therapeutic research involves topical application to chronic venous leg ulcers.
Can LL-37 be used as a nasal spray?
There is no FDA-approved LL-37 nasal spray and no established human clinical protocol for intranasal LL-37 treatment.
Can LL-37 be taken orally?
No established oral LL-37 medication has demonstrated clinical effectiveness. Digestive enzymes can degrade peptides, making oral delivery challenging.
What is the recommended LL-37 dose?
There is no FDA-approved dose. Human wound studies evaluated specific topical concentrations and should not be converted into injectable dosing protocols.
How often is LL-37 used?
No standardized outpatient schedule has been established. Frequency depends on the experimental formulation and route.
Is LL-37 FDA-approved?
No. There is no FDA-approved LL-37 product, route, dose or medical indication.
Can LL-37 be compounded in the United States?
LL-37 is not on FDA's current May 2026 503A Category 1 list. FDA identifies its prior nomination as withdrawn and has published significant safety concerns. Providers and pharmacies should verify current federal and state requirements rather than assuming routine bulk compounding is permitted.
Why did FDA raise concerns about compounded LL-37?
FDA identified concerns involving immunogenicity, peptide-related impurities, active-ingredient characterization, insufficient safety information, nonclinical reproductive effects and possible protumorigenic activity in selected tissues.
Is compounded LL-37 FDA-approved?
No. Compounded medications do not become FDA-approved merely because they are prepared by a pharmacy or prescribed by a clinician.
Can LL-37 affect fertility?
Laboratory research has shown that sufficient LL-37 exposure can impair human sperm motility and membrane integrity. The clinical significance of systemic therapeutic exposure is unknown, but men trying to conceive should use extra caution.
Can LL-37 cause cancer?
There is no evidence proving that LL-37 therapy causes cancer in people. However, LL-37 can influence angiogenesis and tumor biology, and FDA has cited nonclinical concern about protumorigenic activity in some tissues.
Who should use extra caution with LL-37?
Particular caution is appropriate for people trying to conceive, patients with active or previous cancer, autoimmune disease, psoriasis, rosacea, pregnancy, breastfeeding or serious active infection.
Should LL-37 replace antibiotics?
No. LL-37 is investigational and should not delay established antimicrobial treatment for a bacterial infection.
Should I inject research-grade LL-37?
No. Products labeled only for laboratory or research use are not intended for human administration and should not be self-injected.
Explore LL-37 and Immune or Wound-Healing Options in Logansport, IN
LL-37 is a biologically important human host-defense peptide with legitimate research involving antimicrobial activity, biofilms and wound healing.
The evidence also shows why careful interpretation matters. A small human topical wound trial was encouraging, but a larger Phase IIb trial did not demonstrate a benefit across the full study population. Systemic injection protocols remain substantially less studied, and current U.S. compounding status requires additional caution.
A physician-guided evaluation can identify whether a chronic wound, recurrent infection, immune concern or inflammatory condition has an established cause and determine which proven or investigational treatment options are appropriate.
Call (765) 259-0545 or contact Charles Turner MD online to request your consultation.
Medical References
- Topical LL-37 Enhances Healing Measures in Hard-to-Heal Venous Leg Ulcers: Randomized Placebo-Controlled First-in-Human Trial
- LL-37 Participates in Re-Epithelialization of Human Skin Wounds
- Cutaneous Injury Induces Human Cathelicidin Peptides Active Against Group A Streptococcus
- Vitamin D Analogue Treatment Enhances hCAP18/LL-37 Upregulation During Human Skin Wounding
- LL-37 Promotes Endothelial-Cell Activation and Angiogenesis in Wound-Repair Models
- LL-37 Promotes Vascularization and Re-Epithelialization in Experimental Wound Healing
- Human Host-Defense Peptide LL-37 Prevents Pseudomonas aeruginosa Biofilm Formation
- LL-37 Demonstrates Bactericidal Activity Against Staphylococcus aureus Biofilms
- LL-37 Demonstrates Antimicrobial and Antibiofilm Activity Against Staphylococcus aureus From Chronic Wounds
- Human Skin Antimicrobial Peptides Including LL-37 Show Synergistic Activity Against Staphylococcus aureus
Hours and Directions
Innovative Medicine
Address
3554 Promenade PkwySuite H
Lafayette, IN 47909
(765) 259-0545
www.innovativemedicine.org
Hours
Mon:
8:30 am - 5:00 pm
Tue:
8:30 am - 5:00 pm
Wed:
8:30 am - 5:00 pm
Thu:
8:30 am - 5:00 pm
Fri:
Closed
Sat:
Closed
Sun:
Closed
