VIP Peptide Therapy in Indianapolis, IN
VIP peptide therapy uses vasoactive intestinal peptide, a naturally occurring 28-amino-acid neuropeptide involved in communication among the nervous, immune, respiratory, cardiovascular and gastrointestinal systems.
VIP was originally identified in intestinal tissue, which explains its name. Research has since demonstrated that the peptide is widely distributed throughout the body and participates in much more than digestion.
VIP can influence:
- Blood-vessel relaxation
- Airway smooth-muscle relaxation
- Intestinal secretion and motility
- Immune-cell signaling
- Inflammatory responses
- Neural communication
- Penile smooth-muscle relaxation
- Selected endocrine and circadian pathways
The pharmaceutical name aviptadil refers to synthetic vasoactive intestinal peptide corresponding to the human VIP sequence.
Human research has evaluated VIP or aviptadil through inhaled, intravenous, intracavernosal and intranasal routes. The evidence differs substantially by condition and route.
VIP is not an FDA-approved medication in the United States. Intranasal VIP used by some integrative practices is generally a compounded preparation rather than an FDA-approved nasal product.
To learn more about physician-guided VIP peptide therapy and integrative treatment options in Indianapolis, IN, call (765) 259-0545 or contact Charles Turner MD online.
What Is Vasoactive Intestinal Peptide?
Vasoactive intestinal peptide is a naturally occurring peptide containing 28 amino acids.
Its amino-acid sequence is:
His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
The abbreviated sequence is:
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
VIP belongs to the secretin-glucagon peptide family.
Related signaling peptides include:
- Pituitary adenylate cyclase-activating polypeptide, or PACAP
- Secretin
- Glucagon
- Glucose-dependent insulinotropic polypeptide
VIP is produced by neurons in both the central and peripheral nervous systems and by selected immune and endocrine cells.
Is VIP a Hormone, Neuropeptide or Peptide Medication?
VIP can function as several types of biological signal.
It is commonly described as:
- A neuropeptide: because many neurons produce and release VIP
- A neurotransmitter or neuromodulator: because it affects signaling between nerve cells and target tissues
- A peptide hormone: because it can act at tissues beyond its site of release
- An immunoregulatory peptide: because VIP receptors are found on immune cells and can influence cytokine signaling
Synthetic human VIP used in pharmaceutical research is commonly called aviptadil.
Where Is VIP Found in the Body?
VIP is widely distributed.
Important locations include:
- Brain
- Autonomic nerves
- Gastrointestinal tract
- Pancreas
- Lungs and airways
- Blood vessels
- Heart
- Genitourinary tissue
- Immune cells
- Penile tissue
This broad distribution explains why VIP has been studied in respiratory, gastrointestinal, cardiovascular, neurological, inflammatory and sexual-health research.
How Does VIP Work?
VIP primarily binds to two G-protein-coupled receptors:
- VPAC1
- VPAC2
These receptors activate intracellular signaling involving cyclic AMP, commonly called cAMP.
Depending on the cell and tissue involved, VIP receptor activation can influence:
- Smooth-muscle tone
- Blood-vessel diameter
- Airway caliber
- Glandular secretion
- Immune-cell activity
- Cytokine production
- Epithelial function
- Neural signaling
VIP also interacts biologically with PACAP signaling because both peptides can activate VPAC receptors.
VIP, VPAC1 and VPAC2 Receptors
VPAC1 and VPAC2 have overlapping but different tissue distributions.
VPAC1 is expressed in tissues including:
- Immune cells
- Gastrointestinal tissue
- Liver
- Selected brain regions
VPAC2 is found in tissues including:
- Airway smooth muscle
- Blood vessels
- Pancreatic tissue
- Immune cells
- Brain regions involved in circadian regulation
The clinical effects of a VIP product depend on which tissues are exposed, the dose, administration route and receptor expression.
Why Are Patients Interested in VIP Peptide Therapy?
Patients may encounter VIP while researching integrative or peptide-based approaches related to:
- Chronic inflammatory response syndrome
- Environmental or mold-related illness
- Chronic inflammatory symptoms
- Respiratory health
- Pulmonary vascular function
- Immune regulation
- Gastrointestinal function
- Neurological or cognitive symptoms
- Erectile dysfunction
These areas do not have equal levels of evidence.
Human clinical studies involving inhaled VIP and intracavernosal VIP combinations are available. Evidence supporting intranasal VIP for CIRS is more limited and comes largely from small, uncontrolled studies performed within a specific treatment framework.
What Is Aviptadil?
Aviptadil is the international nonproprietary name for synthetic human vasoactive intestinal peptide.
Aviptadil has the same 28-amino-acid sequence associated with human VIP.
Human studies have evaluated aviptadil through routes including:
- Inhalation
- Intravenous administration
- Intracavernosal injection in combination with phentolamine
Aviptadil has received FDA orphan-drug designations for selected rare conditions, including pulmonary arterial hypertension and sarcoidosis.
An orphan-drug designation is not FDA approval.
FDA records continue to identify aviptadil as not FDA-approved for those orphan indications.
VIP vs. Aviptadil
| Comparison | VIP | Aviptadil |
|---|---|---|
| Meaning | Naturally occurring vasoactive intestinal peptide | Pharmaceutical name for synthetic human VIP |
| Length | 28 amino acids | 28 amino acids corresponding to human VIP |
| Primary receptors | VPAC1 and VPAC2 | VPAC1 and VPAC2 |
| Human research | Physiology, pulmonary, immune and sexual-function studies | Pharmaceutical pulmonary and erectile-dysfunction studies |
| FDA-approved U.S. drug | No | No |
In clinical literature, the terms may sometimes be used interchangeably when synthetic VIP is administered.
VIP and the Immune System
VIP has extensive laboratory research involving immune regulation.
VIP receptors are expressed on immune cells including:
- T lymphocytes
- Macrophages
- Dendritic cells
- Other leukocyte populations
Experimental studies have reported effects involving:
- TNF-alpha
- Interleukins
- T-cell differentiation
- Regulatory T-cell activity
- Macrophage signaling
- Innate and adaptive immune responses
This has led to interest in VIP for inflammation and autoimmune disease research.
VIP is not an established replacement for corticosteroids, biologic medications, disease-modifying antirheumatic drugs or other approved immune therapies.
Human VIP Research in Sarcoidosis
One of the more important human immunology studies evaluated inhaled VIP in sarcoidosis.
A Phase 2 open clinical study treated 20 patients with histologically confirmed active sarcoidosis using nebulized VIP for four weeks.
Researchers reported that inhaled VIP:
- Was well tolerated in the study
- Reduced TNF-alpha production by cells recovered from bronchoalveolar lavage
- Increased a population of regulatory T cells within bronchoalveolar lavage fluid
- Produced regulatory activity in immune-cell experiments
The study provided direct human evidence that inhaled VIP can influence immune signaling within the lung.
It did not establish VIP as an FDA-approved treatment for sarcoidosis.
VIP and Chronic Inflammatory Response Syndrome
Some integrative and environmental-medicine practices use intranasal VIP as part of treatment protocols for chronic inflammatory response syndrome, or CIRS .
CIRS is a clinical framework used by some physicians to describe persistent multisystem symptoms attributed to inflammatory responses following environmental exposures, particularly water-damaged buildings.
Symptoms described within this framework may include:
- Fatigue
- Cognitive complaints
- Headaches
- Muscle or joint discomfort
- Respiratory symptoms
- Sleep problems
- Mood changes
- Gastrointestinal symptoms
CIRS diagnostic criteria, biomarker interpretation and treatment protocols are not universally accepted across mainstream medical specialties.
This is important when evaluating VIP treatment claims.
What Does the CIRS VIP Research Show?
A 2013 open-label study evaluated intranasal VIP in 20 patients described as having refractory CIRS after exposure to water-damaged buildings.
Participants used VIP nasal spray for at least 18 months.
The investigators reported favorable changes involving:
- Symptom scores
- Quality of life
- C4a
- TGF-beta1
- VEGF
- MMP-9
- Selected hormone and vitamin measurements
- Exercise-related pulmonary artery pressure
- Regulatory T-cell measurements
The investigators reported no significant adverse effects within the study group.
However, important limitations include:
- Only 20 patients were treated
- The trial was open-label
- There was no randomized placebo group receiving nasal VIP
- Participants had already completed earlier steps of a sequential treatment protocol
- Much of the CIRS-VIP literature comes from the same clinical research network
- Independent large-scale replication remains limited
These limitations mean the results should be considered preliminary rather than definitive evidence of effectiveness.
Intranasal VIP and Brain-Volume Research in CIRS
A later observational study evaluated brain imaging among patients treated within a CIRS protocol that included intranasal VIP.
The investigators reported increases in volume within selected gray-matter regions following treatment.
This finding has contributed to interest in intranasal VIP for patients reporting cognitive or neurological symptoms.
The study did not establish that VIP alone caused the imaging changes because the design was not a large randomized placebo-controlled trial.
Brain-volume findings should also not be interpreted as proof that VIP treats dementia, traumatic brain injury or another neurological disease.
VIP and Transcriptomic Research in CIRS
A small transcriptomic study evaluated 15 patients treated with intranasal VIP within a CIRS framework.
Researchers reported changes in gene-expression patterns involving:
- Innate immune pathways
- Lymphocyte-related signaling
- Mitochondrial gene expression
- Ribosomal pathways
- Selected inflammatory-response genes
The study provides mechanistic information but cannot establish clinical efficacy because it was small and lacked a randomized placebo comparison.
VIP for Mold-Related Illness
Patients often search for VIP nasal spray for mold illness because intranasal VIP is associated with the Shoemaker CIRS protocol.
Environmental exposure should be evaluated before assuming symptoms result from mold.
Potentially relevant considerations include:
- Building moisture
- Visible mold growth
- Occupational exposure
- Allergic disease
- Asthma
- Sinus disease
- Infection
- Other causes of chronic fatigue or cognitive symptoms
Mold-related health concerns may require environmental correction as well as medical evaluation.
VIP should not be used as a substitute for removing a patient from an ongoing hazardous exposure.
Does Low Blood VIP Prove a Patient Needs VIP Therapy?
No.
Some CIRS protocols include plasma VIP measurements.
A laboratory value alone does not establish:
- The cause of chronic symptoms
- That a patient has CIRS
- That the brain or intestine is deficient in VIP
- That nasal VIP will improve symptoms
- The correct treatment dose
VIP is released locally by nerves and tissues, and circulating measurements may not reflect activity within every organ.
Laboratory results should therefore be interpreted within the complete clinical picture.
VIP and Respiratory Function
VIP is an important neuropeptide within the respiratory system.
Potential pulmonary effects include:
- Airway smooth-muscle relaxation
- Pulmonary vasodilation
- Immune regulation
- Epithelial signaling
- Influence on mucus and glandular secretion
This biology has led to human research in asthma, pulmonary hypertension, sarcoidosis and acute lung disease.
VIP and Pulmonary Hypertension
A human study evaluated a single inhaled dose of aviptadil in 20 patients with chronic pulmonary hypertension during right-heart catheterization.
The group included patients with:
- Pulmonary arterial hypertension
- Pulmonary hypertension associated with lung disease
- Chronic thromboembolic pulmonary hypertension
Researchers reported:
- A small but statistically significant selective pulmonary vasodilating effect
- Improved stroke volume
- Improved mixed venous oxygen saturation
- More than a 20% reduction in pulmonary vascular resistance in six patients
- No significant reduction in systemic blood pressure
- No reported side effects from the single inhaled dose
The effect was described as modest and short-lived.
Aviptadil has received FDA orphan-drug designation for pulmonary arterial hypertension, but FDA records state that it is not approved for that orphan indication.
Pulmonary hypertension is a serious condition requiring specialist care.
VIP and Asthma Research
VIP relaxes airway smooth muscle, creating interest in its potential bronchodilator effects.
Small human studies have evaluated inhaled or intravenous VIP in asthma.
One randomized experiment in six patients with atopic asthma found that inhaled VIP reduced responsiveness to a histamine bronchial challenge.
Another small clinical study in patients recovering from severe asthma reported a measurable bronchodilator effect from intravenous VIP, although the effect was less than that of conventional bronchodilator medication.
VIP is not an approved asthma treatment and should not replace:
- Rescue inhalers
- Inhaled corticosteroids
- Long-acting bronchodilators
- Biologic therapy
- Emergency treatment for severe attacks
Patients with asthma should follow an established asthma treatment plan.
VIP and Chronic Obstructive Pulmonary Disease
VIP biology is relevant to airway smooth muscle and pulmonary blood vessels, which has generated interest in chronic obstructive pulmonary disease.
However, VIP has not been established as a standard COPD therapy.
Evidence-based COPD management may include:
- Smoking cessation
- Bronchodilator medication
- Inhaled corticosteroids in selected patients
- Pulmonary rehabilitation
- Vaccination
- Oxygen when indicated
Any experimental peptide therapy should be considered only in addition to appropriate pulmonary care, not as a substitute for it.
VIP and Acute Lung Injury Research
Aviptadil received attention during the COVID-19 pandemic because VIP receptors are present in pulmonary tissues and the peptide has both vasodilatory and immunoregulatory properties.
A randomized, double-blind clinical study of inhaled aviptadil in hospitalized patients reported favorable findings involving:
- Shorter average time to hospital discharge
- Improvement in respiratory symptom scores
- Greater improvement in CT lung-damage scores by day 28
Research in one acute respiratory illness does not establish VIP as a general-purpose lung-healing peptide.
VIP remains unapproved in the United States for acute respiratory distress syndrome or COVID-19.
VIP and Gastrointestinal Function
VIP was first discovered in intestinal tissue and remains an important regulator of gastrointestinal physiology.
Within the digestive system, VIP can influence:
- Intestinal smooth-muscle relaxation
- Water and electrolyte secretion
- Pancreatic secretion
- Biliary function
- Gastrointestinal blood flow
- Enteric nervous-system signaling
These effects help coordinate digestion but also explain why excessive VIP can cause significant disease.
VIP Is Not Simply a Gut-Healing Peptide
VIP is sometimes marketed broadly for gut health because of its location in the enteric nervous system and experimental anti-inflammatory properties.
Human evidence does not establish intranasal or injectable VIP as a treatment for:
- Irritable bowel syndrome
- Inflammatory bowel disease
- Crohn's disease
- Ulcerative colitis
- Increased intestinal permeability or leaky-gut concerns
VIP can stimulate intestinal secretion, meaning that higher peptide activity is not automatically beneficial for every gastrointestinal symptom.
What Is a VIPoma?
A VIPoma is a rare neuroendocrine tumor that produces excessive amounts of VIP.
Very high VIP concentrations can cause a syndrome characterized by:
- Profuse watery diarrhea
- Low potassium
- Dehydration
- Metabolic abnormalities
- Reduced gastric acid production
This condition demonstrates that VIP can produce powerful systemic effects when present in excess.
VIPoma is generally treated by addressing the tumor and controlling hormone secretion. FDA-approved somatostatin analogues such as octreotide may be used for the severe diarrhea associated with VIP-secreting tumors.
That treatment is fundamentally different from administering VIP peptide.
VIP and Erectile Function
VIP participates in penile smooth-muscle relaxation and vascular signaling.
Research has demonstrated VIP release within penile tissue during sexual response and has led to clinical development of intracavernosal VIP-based combinations.
VIP alone can produce penile tumescence, but combination treatment with an alpha-adrenergic blocker such as phentolamine has shown considerably stronger erectile responses.
VIP Plus Phentolamine for Erectile Dysfunction
A large double-blind, placebo-controlled study evaluated intracavernosal VIP combined with phentolamine in men with nonpsychogenic erectile dysfunction.
More than 300 men completed the dose-assessment phase.
Researchers reported:
- An overall initial response rate of approximately 84%
- Significantly greater erectile response with VIP plus phentolamine than placebo
- A median erection duration of approximately 54 minutes among responders
- Transient facial flushing as the most common adverse effect
- A very low reported rate of priapism
A separate multicenter study also reported favorable responses across men with vascular, diabetic, neurological and mixed causes of erectile dysfunction.
A 2025 clinical-practice study involving 308 men with refractory erectile dysfunction reported that approximately 59% resumed penetrative sexual activity after treatment with an aviptadil-phentolamine intracavernosal combination.
This evidence involves VIP combined with phentolamine and injected directly into penile tissue.
It does not demonstrate that intranasal VIP treats erectile dysfunction.
VIP vs. Standard Erectile-Dysfunction Treatments
Evidence-based erectile dysfunction treatment may include:
- PDE5 inhibitor medication
- Vacuum erection devices
- Alprostadil
- Intracavernosal combination therapy
- Hormonal treatment when an endocrine disorder is present
- Penile implants for selected patients
VIP-phentolamine combinations are used outside the United States in some settings but are not FDA-approved as a U.S. VIP medication.
Patients interested in injection treatment can also review intracorporeal injection therapy.
VIP and Blood-Vessel Function
The word vasoactive refers to VIP's ability to influence blood-vessel tone.
VIP can relax vascular smooth muscle and lower vascular resistance in selected tissues.
This contributes to:
- Pulmonary vasodilation
- Changes in regional blood flow
- Penile vascular effects
- Potential blood-pressure changes at sufficient systemic exposure
Patients with low blood pressure or medications that lower blood pressure require additional caution.
VIP and Neurological Function
VIP is widely distributed in the nervous system.
Research implicates VIP in:
- Neuronal communication
- Circadian signaling
- Neuroimmune regulation
- Neurovascular function
- Learning and memory pathways
- Stress responses
These biological roles have generated interest in VIP for cognitive and neurological symptoms.
Human evidence does not establish intranasal VIP as a treatment for:
- Alzheimer's disease
- Parkinson's disease
- Traumatic brain injury
- Post-concussion syndrome
- Memory loss
- Other neurodegenerative diseases
Patients with persistent cognitive symptoms should receive an appropriate neurological and medical evaluation.
VIP and Circadian Rhythm
VIP signaling is important within the suprachiasmatic nucleus, the brain region that helps coordinate circadian rhythm.
VIP-producing neurons help synchronize cellular clocks within this system.
This has generated scientific interest in VIP and sleep-wake regulation.
However, VIP has not been established as a treatment for insomnia , circadian-rhythm disorders or sleep apnea .
VIP Nasal Spray
Intranasal VIP is the form most commonly discussed by integrative practices.
The nasal route is attractive because it:
- Avoids gastrointestinal peptide degradation
- Is noninvasive
- Provides access to a highly vascular mucosal surface
- Has been used in published CIRS studies
However, there is no FDA-approved VIP nasal spray.
Commercial or compounded formulations may differ in:
- Peptide concentration
- Salt or chemical form
- Preservatives
- Spray volume
- Delivery device
- Storage conditions
- Stability
Results from one compounded or research formulation should not automatically be attributed to another.
Does Nasal VIP Go Directly to the Brain?
The intranasal route is studied for peptide delivery because the nasal cavity has neural and vascular pathways that may influence central exposure.
However, claims that a specific outpatient VIP spray delivers a predictable percentage of medication directly to the brain are not clinically established.
Biological effects may result from:
- Local nasal activity
- Systemic absorption
- Neural pathways
- A combination of mechanisms
Clinical claims should therefore be based on measured patient outcomes rather than assumptions about direct brain delivery.
VIP Inhalation vs. VIP Nasal Spray
Inhaled pulmonary VIP and intranasal VIP are different routes.
| Comparison | Inhaled / Nebulized VIP | Intranasal VIP |
|---|---|---|
| Primary target | Lower respiratory tract and pulmonary circulation | Nasal mucosa with systemic and possibly neural exposure |
| Human research | Pulmonary hypertension, sarcoidosis, asthma and acute respiratory illness | Primarily CIRS-related observational and open-label research |
| Delivery device | Nebulizer or pulmonary inhalation system | Nasal spray |
| FDA-approved product | No | No |
A pulmonary inhalation study should not be used to prove that nasal VIP produces the same lung exposure.
VIP Injections
Research has also administered VIP or aviptadil intravenously and intracavernosally.
Systemic injection can produce more pronounced vascular effects than nasal administration.
Potential concerns include:
- Flushing
- Blood-pressure changes
- Rapid heart rate
- Headache
- Gastrointestinal effects
There is no FDA-approved injectable aviptadil or VIP therapy for general inflammatory, pulmonary or wellness use in the United States.
Is There an Established VIP Dose?
No universal outpatient VIP dose has been established.
Published studies have used markedly different protocols depending on:
- Administration route
- Condition being studied
- Peptide formulation
- Acute vs. chronic treatment
- Study design
For example, doses used in:
- Pulmonary inhalation studies
- Intranasal CIRS protocols
- Intravenous research
- Intracavernosal erectile-dysfunction therapy
are not interchangeable.
A study dose should not be converted into a self-treatment protocol.
How Long Does VIP Therapy Take to Work?
There is no single validated onset time.
VIP can produce rapid smooth-muscle or vascular effects when delivered directly to a target tissue, while proposed immune or neurological changes may require longer treatment periods.
For example:
- Pulmonary hemodynamic studies measured effects after a single inhaled dose
- Erectile-dysfunction studies measured responses after intracavernosal injection
- CIRS studies evaluated intranasal treatment over months
These timelines describe research protocols rather than guaranteed clinical expectations.
Current FDA Status of VIP and Aviptadil
VIP and aviptadil are not FDA-approved medications in the United States.
FDA has granted orphan-drug designation to aviptadil or VIP for selected conditions including:
- Pulmonary arterial hypertension
- Sarcoidosis
- Acute respiratory distress syndrome
- Historically, acute esophageal food impaction
Orphan-drug designation supports development for a rare disease but does not mean that FDA has approved the drug.
FDA records identify aviptadil as not FDA-approved for its pulmonary arterial hypertension and sarcoidosis orphan indications.
Current U.S. Compounding Status of VIP
As of May 14, 2026, FDA lists vasoactive intestinal peptide in 503A Category 1, meaning the substance was nominated for the 503A Bulks List with sufficient information for FDA to evaluate it and remains under evaluation.
FDA's current interim policy states that the agency generally does not intend to take regulatory action against a qualifying state-licensed pharmacy, federal facility or licensed physician compounding from a Category 1 substance when all conditions of the policy and Section 503A are satisfied.
Those conditions include requirements involving:
- The bulk substance remaining in Category 1
- Registered manufacturers
- A valid certificate of analysis
- Compliance with all other applicable Section 503A requirements
Category 1 status does not mean:
- VIP is FDA-approved
- FDA has determined VIP is safe and effective for CIRS
- Every compounded VIP product complies with federal law
- Every route or dose has been evaluated
Because compounding status can change, providers should verify the current FDA list and applicable state requirements before representing compounded VIP as available.
Compounded VIP Is Not FDA-Approved
Compounded medications are not FDA-approved.
FDA does not conduct premarket review of each compounded VIP formulation for:
- Safety
- Effectiveness
- Manufacturing quality
- Stability
- Labeling
This makes pharmacy selection and physician oversight especially important.
Patients can learn more about individualized preparations through compounding pharmacy services.
Product Quality and Stability Considerations
Peptides can be sensitive to:
- Temperature
- Light
- Oxidation
- pH
- Repeated handling
- Microbial contamination
A physician or pharmacist should provide specific instructions regarding:
- Refrigeration
- Expiration or beyond-use date
- Spray-device use
- Cleaning or contamination prevention
- Travel and temperature exposure
Do not use a peptide product labeled only for laboratory or research use.
What Are the Possible Side Effects of VIP?
Potential effects depend on the route and systemic exposure.
Reported or biologically plausible effects may include:
- Facial flushing
- Headache
- Dizziness
- Low blood pressure
- Fast heart rate or palpitations
- Nasal irritation with intranasal use
- Cough or airway irritation with inhalation
- Abdominal cramping
- Loose stools or diarrhea
- Nausea
- Allergic or immune reactions
In erectile-dysfunction trials involving VIP plus phentolamine, facial flushing was a common adverse effect.
Long-term safety of chronic intranasal VIP outside research settings has not been established through large randomized trials.
VIP and Low Blood Pressure
VIP is a vasodilator.
Patients who already have low blood pressure may be more susceptible to:
- Dizziness
- Weakness
- Lightheadedness
- Fainting
Extra caution may also be appropriate when VIP is combined with:
- Blood-pressure medication
- Nitrates
- Alpha blockers
- Other vasodilators
- Erectile-dysfunction medications
A physician should review medications before treatment.
Who May Not Be a Candidate for VIP Therapy?
Extra caution or specialist review is appropriate for patients who:
- Are pregnant or breastfeeding
- Have significant low blood pressure
- Have unstable cardiovascular disease
- Have severe arrhythmias
- Have active severe gastrointestinal diarrhea
- Have an active serious infection
- Have an unexplained neuroendocrine tumor
- Use multiple vasodilating medications
- Have a history of serious peptide reactions
- Are participating in a clinical trial
The absence of one of these conditions does not automatically establish that VIP is appropriate.
Physician-Guided VIP Evaluation
A consultation should begin with the symptoms and diagnosis being addressed rather than with a predetermined VIP prescription.
Your physician may review:
- Environmental exposure history
- Respiratory symptoms
- Cardiovascular symptoms
- Blood pressure
- Chronic inflammatory symptoms
- Gastrointestinal symptoms
- Cognitive or neurological concerns
- Sexual function
- Current medications
- Previous peptide or compounded treatment
- Allergies and adverse reactions
- Existing specialist diagnoses
Symptoms attributed to CIRS or low VIP can overlap with many established conditions.
Evaluation may identify a more specific diagnosis requiring established treatment.
Testing Before VIP Therapy
There is no universally accepted test that determines whether a person needs VIP therapy.
Testing should be selected according to the clinical problem.
Possible assessments may include:
- Complete blood count
- Comprehensive metabolic panel
- Inflammatory measurements
- Thyroid testing
- Hormone testing when clinically indicated
- Oxygen saturation
- Blood-pressure measurements
- Pulmonary function testing
- Cardiopulmonary evaluation
- Environmental or allergy evaluation
- Additional blood testing based on symptoms
A plasma VIP measurement may be used within selected integrative protocols, but it should not be interpreted in isolation.
VIP Therapy Should Address a Defined Goal
If an investigational or compounded VIP trial is considered, the patient and physician should define measurable goals before treatment.
Depending on the indication, these may include:
- Symptom scores
- Exercise capacity
- Respiratory measurements
- Blood pressure
- Quality-of-life assessments
- Cognitive symptoms
- Gastrointestinal symptoms
- Sexual-function outcomes
- Medication use
Treatment should be reconsidered if there is no measurable benefit or if adverse effects occur.
VIP vs. KPV Peptide Therapy
VIP and KPV peptide therapy are both discussed for inflammatory goals, but they are very different peptides.
| Comparison | VIP | KPV |
|---|---|---|
| Length | 28 amino acids | 3 amino acids |
| Origin | Naturally occurring neuropeptide | C-terminal fragment of alpha-MSH |
| Primary research | Vascular, pulmonary, neuroimmune and gastrointestinal signaling | Inflammatory signaling, intestinal epithelial cells and skin cells |
| Human therapeutic evidence | Several pulmonary and erectile-dysfunction studies plus limited CIRS studies | Primarily cellular and preclinical evidence |
| FDA-approved treatment | No | No |
Research involving one peptide should not be attributed to the other.
VIP vs. Thymosin Alpha 1
VIP and thymosin alpha 1 peptide therapy are both associated with immune research but act through different biological systems.
VIP primarily signals through VPAC receptors and has prominent vascular, airway and neuroimmune effects.
Thymosin alpha 1 is a 28-amino-acid immune-modulating peptide studied in infectious disease, immune dysfunction and supportive oncology settings.
They should not be treated as interchangeable immune peptides.
Can VIP Be Combined With Other Peptides?
Some integrative practices combine VIP with peptides or therapies directed at:
- Inflammation
- Immune function
- Gut health
- Hormonal balance
- Recovery
Controlled human trials have not established the safety or effectiveness of most VIP peptide combinations.
Starting several therapies simultaneously can make it difficult to determine:
- Which treatment produced improvement
- Which treatment caused an adverse effect
- Whether every treatment is necessary
A stepwise integrative medicine plan may make treatment response easier to evaluate.
Frequently Asked Questions About VIP Peptide Therapy
What is VIP peptide therapy?
VIP peptide therapy uses vasoactive intestinal peptide, a 28-amino-acid neuropeptide involved in blood-vessel tone, airway relaxation, gastrointestinal signaling and immune regulation.
What does VIP stand for?
VIP stands for vasoactive intestinal peptide. It is also historically called vasoactive intestinal polypeptide.
What is aviptadil?
Aviptadil is the pharmaceutical name for synthetic human vasoactive intestinal peptide.
Is VIP the same as aviptadil?
Aviptadil corresponds to synthetic human VIP and activates the same primary receptors. The term aviptadil is generally used in pharmaceutical development and clinical research.
What are the benefits of VIP peptide therapy?
Human studies have reported physiological or clinical effects involving pulmonary vasodilation, immune signaling in sarcoidosis and erectile response when VIP is combined with phentolamine. Intranasal CIRS studies have reported favorable findings but remain preliminary.
How does VIP work?
VIP primarily activates VPAC1 and VPAC2 receptors, increasing intracellular cAMP and influencing smooth-muscle tone, secretion, vascular function and immune signaling.
Is VIP an anti-inflammatory peptide?
VIP has immunoregulatory and anti-inflammatory effects in laboratory models, and an inhaled human sarcoidosis study reported reduced TNF-alpha production. It is not an approved general anti-inflammatory medication.
Does VIP help CIRS?
Small open-label and observational studies from the CIRS research community have reported favorable symptom, biomarker and imaging findings with intranasal VIP. Large independent randomized trials have not yet established effectiveness.
Is VIP nasal spray used for mold illness?
Some integrative physicians use compounded intranasal VIP within CIRS protocols associated with illness attributed to water-damaged buildings. This remains an off-label, non-FDA-approved approach.
Does VIP reverse brain changes from CIRS?
An observational study reported increased volume in selected gray-matter regions during treatment that included intranasal VIP. The study design does not prove that VIP alone caused those changes.
Does VIP improve pulmonary hypertension?
A small human study found modest, short-lived pulmonary vasodilation after a single inhaled aviptadil dose. Aviptadil is not FDA-approved for pulmonary hypertension.
Can VIP help sarcoidosis?
A 20-patient Phase 2 open study reported favorable immune changes after four weeks of inhaled VIP. This supports further research but does not establish an approved sarcoidosis treatment.
Can VIP help asthma?
Small human studies reported bronchodilator or bronchoprotective effects, but VIP is not an FDA-approved asthma treatment and should not replace standard inhalers or biologic therapy.
Can VIP help COPD?
VIP has relevant airway and pulmonary vascular biology, but it has not been established as a standard treatment for COPD.
Does VIP help erectile dysfunction?
Clinical trials have shown favorable erectile responses when VIP or aviptadil is combined with phentolamine and injected intracavernosally. This does not establish intranasal VIP as an erectile-dysfunction treatment.
Is VIP a gut peptide?
Yes. VIP is an important enteric neuropeptide involved in intestinal smooth-muscle relaxation, secretion and blood flow. It also has major roles outside the digestive system.
Can VIP treat IBS?
No controlled evidence establishes VIP as a standard IBS treatment. Because VIP can increase intestinal secretion, excessive activity may actually contribute to diarrhea.
Can VIP treat inflammatory bowel disease?
Preclinical research is relevant to immune and intestinal signaling, but human evidence does not establish VIP as a treatment for Crohn's disease or ulcerative colitis.
What happens if VIP levels are too high?
Extremely high VIP levels can occur with rare VIP-secreting neuroendocrine tumors and may cause severe watery diarrhea, low potassium and dehydration.
What is a VIPoma?
A VIPoma is a rare neuroendocrine tumor that secretes excessive vasoactive intestinal peptide. It is treated by addressing the tumor and controlling hormone-related symptoms, not by administering more VIP.
How is VIP administered?
Research has used inhaled, intravenous, intranasal and intracavernosal administration. The appropriate route depends entirely on the research or medical goal.
Is VIP nasal spray FDA-approved?
No. There is no FDA-approved intranasal VIP product in the United States.
Is aviptadil FDA-approved?
No. FDA has granted orphan-drug designations for aviptadil in selected conditions, but orphan designation is not approval.
Can VIP be compounded?
As of May 14, 2026, vasoactive intestinal peptide appears in FDA 503A Category 1 as a bulk drug substance under evaluation. FDA's interim policy may allow qualifying compounding when all applicable conditions are met. Category 1 status is not FDA approval.
Does FDA Category 1 mean VIP is safe and effective?
No. Category 1 means the substance was nominated with sufficient information for FDA evaluation and remains under review. It does not establish safety, effectiveness or approval for any condition.
What is the recommended VIP nasal spray dose?
There is no FDA-approved intranasal dose. Published CIRS protocols and compounded preparations vary, and a research dose should not be treated as a universal prescription.
How long is VIP therapy used?
Duration depends on the research setting. CIRS studies have examined prolonged use, while pulmonary and erectile-dysfunction studies have examined acute administration. No universal treatment duration has been established.
What are the side effects of VIP?
Possible effects include flushing, headache, dizziness, low blood pressure, palpitations, nasal or airway irritation, abdominal symptoms, diarrhea and allergic reactions. Risks depend on dose and route.
Can VIP lower blood pressure?
Yes. VIP is a vasodilating peptide and can influence vascular resistance. Patients with low blood pressure or multiple vasodilating medications require additional caution.
Can VIP be used during pregnancy?
Human safety data for chronic intranasal VIP during pregnancy are inadequate. Pregnancy should be discussed with the prescribing clinician before any investigational peptide is used.
Can VIP be combined with KPV or thymosin alpha 1?
These combinations may be discussed by peptide practices, but controlled human trials have not established that combining them improves outcomes or long-term safety.
Should I buy VIP labeled for research use?
No. Products labeled solely for laboratory or research use are not intended as patient medications and should not be self-administered.
Explore VIP Peptide Therapy in Indianapolis, IN
VIP is an important neuroimmune, vascular and gastrointestinal signaling peptide with legitimate human research, but its evidence varies substantially according to the condition and administration route.
Human studies support measurable effects in selected pulmonary and erectile-dysfunction settings. Intranasal VIP research for CIRS is promising but remains limited by small sample sizes, open-label designs and lack of broad independent replication.
A physician-guided evaluation can help determine whether an established diagnosis explains your symptoms, whether standard treatment should be prioritized and whether a compounded or investigational approach is appropriate.
Call (765) 259-0545 or contact Charles Turner MD online to request your consultation.
Medical References
- Inhaled Vasoactive Intestinal Peptide Exerts Immunoregulatory Effects in Sarcoidosis
- Inhalation of Vasoactive Intestinal Peptide Produces Selective Pulmonary Vasodilation in Pulmonary Hypertension
- Inhaled Vasoactive Intestinal Peptide Reduces Bronchial Reactivity to Histamine in Humans
- Vasoactive Intestinal Peptide Produces Bronchodilation in Severe Asthma
- Randomized Controlled Study of Inhaled Aviptadil in Acute COVID-19-Related Lung Disease
- Double-Blind Placebo-Controlled Study of Intracavernosal VIP and Phentolamine for Erectile Dysfunction
- Multicenter Placebo-Controlled Study of VIP and Phentolamine for Nonpsychogenic Erectile Dysfunction
- Intracavernosal Aviptadil and Phentolamine for Refractory Erectile Dysfunction
- Open-Label Intranasal VIP Study in Chronic Inflammatory Response Syndrome Associated With Water-Damaged Buildings
- Intranasal VIP and Gray-Matter Volume Findings in Patients Treated for Chronic Inflammatory Response Syndrome
- RNA-Seq Findings During Intranasal VIP Treatment in Chronic Inflammatory Response Syndrome
Hours and Directions
Innovative Medicine
Address
3554 Promenade PkwySuite H
Lafayette, IN 47909
(765) 259-0545
www.innovativemedicine.org
Hours
Mon:
8:30 am - 5:00 pm
Tue:
8:30 am - 5:00 pm
Wed:
8:30 am - 5:00 pm
Thu:
8:30 am - 5:00 pm
Fri:
Closed
Sat:
Closed
Sun:
Closed
